PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G01148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 204aa    MW: 24385.4 Da    PI: 8.0269
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G01148genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.48.1e-191663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd ll+++vk +G+g+W++Ia++ g++R++k+c++rw +yl
       AA32G01148 16 KGLWTVEEDNLLIHYVKSHGKGHWNRIAKKTGLKRCGKSCRLRWMNYL 63
                     678*******************************************97 PP

2Myb_DNA-binding56.65.7e-1869114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g +T +E++l+++++++lG++ W++Ia++++ gRt++q+k++w+++l
       AA32G01148  69 KGHFTDQEEDLILRLHRLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 114
                      689*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.1721163IPR017930Myb domain
SuperFamilySSF466891.08E-3014110IPR009057Homeodomain-like
SMARTSM007172.5E-161565IPR001005SANT/Myb domain
PfamPF002492.6E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-241770IPR009057Homeodomain-like
CDDcd001676.58E-121963No hitNo description
PROSITE profilePS5129426.75564118IPR017930Myb domain
SMARTSM007171.1E-1768116IPR001005SANT/Myb domain
PfamPF002493.5E-1769114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2671117IPR009057Homeodomain-like
CDDcd001671.28E-1172114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MRIKKINEEE NNEYKKGLWT VEEDNLLIHY VKSHGKGHWN RIAKKTGLKR CGKSCRLRWM  60
NYLSPNVKKG HFTDQEEDLI LRLHRLLGNR WSLIAKRVPG RTDNQVKNYW NTHLSKKFRI  120
KNQRLISNVD DDDKVMNHLV KLSEDKTCIE DDQERVQNQE HGVDEDEEHK NYMNSSGWTH  180
HGDEFELSAL TYMMDFFDGQ YCSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-291111822128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010435623.16e-84PREDICTED: transcription factor WER-like
SwissprotQ9SEI04e-83WER_ARATH; Transcription factor WER
TrEMBLA0A0D3AJ347e-83A0A0D3AJ34_BRAOL; Uncharacterized protein
STRINGAT5G14750.11e-80(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.15e-79myb domain protein 66